Structure of PDB 6uxv Chain A

Receptor sequence
>6uxvA (length=140) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SHSNIDYQTLLANSDHAKFTIEPGVLPVGIDTHTATDIYQTLIALNLDTT
VNDCLDKLLNDECTESTRENALYDYYALQLLPLQKAVRGHVLQFEWHQNS
LLTNTHPNFLSKIRNINVQDALLTNQLYKNHELLKLERKK
3D structure
PDB6uxv Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
ChainA
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A N462 T478 I479 N4 T20 I21
BS02 peptide A Q577 Q584 Q119 Q126
Gene Ontology
Molecular Function
GO:0000182 rDNA binding
GO:0003677 DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0031492 nucleosomal DNA binding
GO:0042393 histone binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0070577 lysine-acetylated histone binding
GO:0140566 histone reader activity
GO:0140658 ATP-dependent chromatin remodeler activity
Biological Process
GO:0006261 DNA-templated DNA replication
GO:0006302 double-strand break repair
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0031496 positive regulation of mating type switching
GO:0034198 cellular response to amino acid starvation
GO:0035973 aggrephagy
GO:0042148 DNA strand invasion
GO:0045815 transcription initiation-coupled chromatin remodeling
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1900189 positive regulation of cell adhesion involved in single-species biofilm formation
GO:2000219 positive regulation of invasive growth in response to glucose limitation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0016514 SWI/SNF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uxv, PDBe:6uxv, PDBj:6uxv
PDBsum6uxv
PubMed32188938
UniProtP22082|SNF2_YEAST Transcription regulatory protein SNF2 (Gene Name=SNF2)

[Back to BioLiP]