Structure of PDB 6uxq Chain A

Receptor sequence

>6uxqA (length=84) Species: 9606 (Homo sapiens)

GPLGSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTK
IATSLFESGINWGRVVALLGFGYRLALHVYQHGL

3D structure

• PDB: 6uxq BAK core dimers bind lipids and can be bridged by them.
• Chain: A
• Resolution: 1.696 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	C8E	A	Y136 A139	Y73 A76
BS02	C8E	A	E120 S121	E57 S58
BS03	C8E	A	N124 W125	N61 W62
BS04	LBN	A	L132 Y136	L69 Y73

Gene Ontology

Biological Process

• GO:0042981 regulation of apoptotic process

External links

• PDB: RCSB:6uxq, PDBe:6uxq, PDBj:6uxq
• PDBsum: 6uxq
• PubMed: 32929280
• UniProt: Q16611|BAK_HUMAN Bcl-2 homologous antagonist/killer (Gene Name=BAK1)