Structure of PDB 6uwh Chain A

Receptor sequence

>6uwhA (length=294) Species: 32630 (synthetic construct)

SSINPWILTGFADAEGSFLLRIRKNNKSSVGYSTELGFQITLHNKDKSIL
ENIQSTWGVGVIANSGDNAVSLKVTRFEDLKVIIDHFEKYPLITQKYADY
MLFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIISKE
RSLINKNIPNFKWLAGFTSGDGCFFVNLIKSKSKLGVQVQLVFSISQHIR
DKNLMNSLITYLGCGYIKKKNKSEFSWLEFVVTKFSDIRDKIIPFFQEYT
LIGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKGR

3D structure

• PDB: 6uwh Optimization of Protein Thermostability and Exploitation of Recognition Behavior to Engineer Altered Protein-DNA Recognition.
• Chain: A
• Resolution: 2.299 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K34 S35 S36 E42 V68 R83 F84 H122 W140 G177 D178 G179 C180 F182 N184 I186 S203 Q204 H205 F232 W234 K262 N298 K299	K27 S28 S29 E35 V61 R76 F77 H115 W133 G170 D171 G172 C173 F175 N177 I179 S196 Q197 H198 F225 W227 K255 N291 K292
BS02	dna	A	S24 R28 R30 H50 K80 N139 W140 Q195 Q197 K225 K227 T240 K241 F242 H281 K299 G300	S17 R21 R23 H43 K73 N132 W133 Q188 Q190 K218 K220 T233 K234 F235 H274 K292 G293
BS03	CA	A	A21 D178	A14 D171
BS04	CA	A	E22 G177	E15 G170
BS05	CA	A	F182 K294	F175 K287
BS06	CA	A	E22 T48	E15 T41

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 19:09:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6uwh', asym_id = 'A', title = 'Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6uwh', asym_id='A', title='Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '6uwh', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='6uwh', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>