Structure of PDB 6uwf Chain A

Receptor sequence

>6uwfA (length=416) Species: 53953 (Pyrococcus horikoshii)

MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLF
VRLLKMLVMPIVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLG
IIMARLFNPGAGIHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQ
VLPTIFFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNG
VMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVL
LKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASI
GTAGVPGAGAIMLAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMV
NVTGDLTGTAIVAKTE

3D structure

• PDB: 6uwf Use of paramagnetic 19 F NMR to monitor domain movement in a glutamate transporter homolog.
• Chain: A
• Resolution: 3.08 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ASP	A	S278 T314 G354 A358 G359 D394 R397 T398 N401	S278 T314 G354 A358 G359 D394 R397 T398 N401
BS02	6OU	A	P128 I133 I309 I350 G351	P128 I133 I309 I350 G351
BS03	6OU	A	Y4 Y7 K196 I197	Y4 Y7 K196 I197

Gene Ontology

Molecular Function

• GO:0005283 amino acid:sodium symporter activity
• GO:0015108 chloride transmembrane transporter activity
• GO:0015183 L-aspartate transmembrane transporter activity
• GO:0015293 symporter activity
• GO:0015501 glutamate:sodium symporter activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006865 amino acid transport
• GO:0035725 sodium ion transmembrane transport
• GO:0046942 carboxylic acid transport
• GO:0070207 protein homotrimerization
• GO:0070778 L-aspartate transmembrane transport
• GO:0140009 L-aspartate import across plasma membrane
• GO:1902476 chloride transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:6uwf, PDBe:6uwf, PDBj:6uwf
• PDBsum: 6uwf
• PubMed: 32514183
• UniProt: O59010|GLT_PYRHO Glutamate transporter homolog (Gene Name=PH1295)