Structure of PDB 6uvw Chain A

Receptor sequence

>6uvwA (length=295) Species: 32630 (synthetic construct)

SINPWILTGFADAEGSFLLRIRKNNKSSVGYSTELGFQITLHNKDKSILE
NIQSTWGVGVIANSGDNAVSLKVTRFEDLKVIIDHFEKYPLITQKYADYM
LFKQAFNVMENKEHLTIEGIKELVRIKAKLNWGLTDELKKAFPEIISKER
SLINKNIPNFKWLAGFTSGEGCFFVNLIKSKSKLGVQVQLVFSITQHIRD
KNLMNSLITYLGCGYIKKKNKSEFSWLDFVVTKFSDIRDKIIPFFQEYTL
IGTKLKDFEDWCKVAKLIEEKKHLTEEGLDEIKKIKLNMNKGRVF

3D structure

• PDB: 6uvw Optimization of Protein Thermostability and Exploitation of Recognition Behavior to Engineer Altered Protein-DNA Recognition.
• Chain: A
• Resolution: 2.551 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K34 S35 S36 E42 S72 R83 F84 H122 G177 E178 G179 C180 F182 N184 I186 T203 Q204 H205 F232 W234 K262 N298 K299	K26 S27 S28 E34 S64 R75 F76 H114 G169 E170 G171 C172 F174 N176 I178 T195 Q196 H197 F224 W226 K254 N290 K291
BS02	dna	A	A21 E22 S24 R28 R30 Q46 T48 L49 H50 K80 K103 N139 W140 E178 Q195 Q197 Y223 K225 K227 K229 W234 T240 K241 F242 H281	A13 E14 S16 R20 R22 Q38 T40 L41 H42 K72 K95 N131 W132 E170 Q187 Q189 Y215 K217 K219 K221 W226 T232 K233 F234 H273
BS03	CA	A	A21 E178	A13 E170
BS04	CA	A	E22 G177	E14 G169
BS05	CA	A	E22 E178	E14 E170

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 07:40:19 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6uvw', asym_id = 'A', title = 'Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6uvw', asym_id='A', title='Optimization of Protein Thermostability and Expl...vior to Engineer Altered Protein-DNA Recognition.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '6uvw', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='6uvw', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>