Structure of PDB 6uv2 Chain A

Receptor sequence

>6uv2A (length=431) Species: 9606 (Homo sapiens)

WDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVF
AFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGK
TLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCS
RLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTY
LVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFL
RDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKT
IIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPI
LIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTF
FTPGNLKQARELIKVLEEANQAINPKLMQLV

3D structure

• PDB: 6uv2 RNA Specificity and Autoregulation of DDX17, a Modulator of MicroRNA Biogenesis.
• Chain: A
• Resolution: 1.894 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P173 T174 R175 G201 G202 T222 G224 R225 D228 R250 F256 Q259 E347 T348 K349 H370 G371 R378 T396 V398 N418	P131 T132 R133 G159 G160 T180 G182 R183 D186 R208 F214 Q217 E305 T306 K307 H328 G329 R336 T354 V356 N376
BS02	ADP	A	F112 T116 Q119 G139 S140 G141 K142 T143 D404 R432	F70 T74 Q77 G97 S98 G99 K100 T101 D362 R390
BS03	BEF	A	T138 K142 R429 R432	T96 K100 R387 R390
BS04	MG	A	R130 D131 D294	R88 D89 D252
BS05	MG	A	K53 G129 D131 Q272	K11 G87 D89 Q230
BS06	MG	A	N302 E304 S306	N260 E262 S264

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0005524 ATP binding

External links

• PDB: RCSB:6uv2, PDBe:6uv2, PDBj:6uv2
• PDBsum: 6uv2
• PubMed: 31851931
• UniProt: Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 (Gene Name=DDX17)