Structure of PDB 6uph Chain A

Receptor sequence
>6uphA (length=93) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
ELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMA
LQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQF
3D structure
PDB6uph Cryoelectron Microscopy Structure of a Yeast Centromeric Nucleosome at 2.7 angstrom Resolution.
ChainA
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R177 W178 T212 R42 W43 T77
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019237 centromeric DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000278 mitotic cell cycle
GO:0009303 rRNA transcription
GO:0030543 2-micrometer plasmid partitioning
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005729 2-micrometer circle DNA
GO:0005777 peroxisome
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uph, PDBe:6uph, PDBj:6uph
PDBsum6uph
PubMed32004465
UniProtP36012|CENPA_YEAST Histone H3-like centromeric protein CSE4 (Gene Name=CSE4)

[Back to BioLiP]