Structure of PDB 6uib Chain A

Receptor sequence
>6uibA (length=132) Species: 9606 (Homo sapiens) [Search protein sequence]
SPAWTQCQQLSQKLCTLAWSAHPLVGHTNDVPHIQCGDGCDPQGLRDNSQ
FCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQP
WQRLLLRFKILRSLQAFVAVAARVFAHGAATL
3D structure
PDB6uib Integration of phage and yeast display platforms: A reliable and cost effective approach for binning of peptides as displayed on-phage.
ChainA
Resolution2.74 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A K20 C22 T23 W26 S27 P30 L31 K13 C15 T16 W19 S20 P23 L24
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0045519 interleukin-23 receptor binding
Biological Process
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002230 positive regulation of defense response to virus by host
GO:0002827 positive regulation of T-helper 1 type immune response
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0032693 negative regulation of interleukin-10 production
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032729 positive regulation of type II interferon production
GO:0032733 positive regulation of interleukin-10 production
GO:0032735 positive regulation of interleukin-12 production
GO:0032740 positive regulation of interleukin-17 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0032816 positive regulation of natural killer cell activation
GO:0032819 positive regulation of natural killer cell proliferation
GO:0034105 positive regulation of tissue remodeling
GO:0042098 T cell proliferation
GO:0042102 positive regulation of T cell proliferation
GO:0042104 positive regulation of activated T cell proliferation
GO:0043382 positive regulation of memory T cell differentiation
GO:0045087 innate immune response
GO:0045672 positive regulation of osteoclast differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048771 tissue remodeling
GO:0050729 positive regulation of inflammatory response
GO:0050829 defense response to Gram-negative bacterium
GO:0051135 positive regulation of NK T cell activation
GO:0051142 positive regulation of NK T cell proliferation
GO:0051607 defense response to virus
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097696 cell surface receptor signaling pathway via STAT
GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction
GO:2000318 positive regulation of T-helper 17 type immune response
GO:2000330 positive regulation of T-helper 17 cell lineage commitment
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005788 endoplasmic reticulum lumen
GO:0070743 interleukin-23 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uib, PDBe:6uib, PDBj:6uib
PDBsum6uib
PubMed32479512
UniProtQ9NPF7|IL23A_HUMAN Interleukin-23 subunit alpha (Gene Name=IL23A)

[Back to BioLiP]