Structure of PDB 6ug4 Chain A |
>6ug4A (length=94) Species: 226186 (Bacteroides thetaiotaomicron VPI-5482) [Search protein sequence] |
DYIPEPMDLSLVDLPESLIQLSERIAENVHEVWAKARIDEGWTYGEKRDD IHKKHPCLVPYDELPEEEKEADRNTAMNTIKMVKKLGFRIEKED |
|
PDB | 6ug4 Open Dimer of Y77A Mutant Putative Ryanodine Receptor from Bacteroides thetaiotaomicron VPI-5482 |
Chain | A |
Resolution | 2.295 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CFF |
A |
A77 D78 T81 |
A71 D72 T75 |
|
|
|
|