Structure of PDB 6uee Chain A

Receptor sequence

>6ueeA (length=258) Species: 381754 (Pseudomonas aeruginosa PA7)

MSLIDPRAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGPT
KIGKHNRIYQFSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQ
DRAETTIGDHNLIMAYAHIGHDSVIGNHCILVNNTALAGHVHVDDWAILS
GYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAEARSMNFEGMRR
RGFSSEAIHALRRAYKVVYRQGHTVEEALAELAESAAQFPEVAVFRDSIQ
SATRGITR

3D structure

• PDB: 6uee Discovery of dual-activity small-molecule ligands of Pseudomonas aeruginosa LpxA and LpxD using SPR and X-ray crystallography.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H121 D122 G139
• Catalytic site (residue number reindexed from 1): H121 D122 G139
• Enzyme Commision number: 2.3.1.129: acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	Q5M	A	H118 A136 A138 H156 Q157	H118 A136 A138 H156 Q157
BS02	Q5M	A	L3 D5 V22 G23 P24 V39 G41 P42 R57	L3 D5 V22 G23 P24 V39 G41 P42 R57
BS03	Q5M	A	V132 N133 G151	V132 N133 G151

Gene Ontology

Molecular Function

• GO:0008780 acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity

Biological Process

• GO:0008610 lipid biosynthetic process
• GO:0009245 lipid A biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6uee, PDBe:6uee, PDBj:6uee
• PDBsum: 6uee
• PubMed: 31664082
• UniProt: A6V1E4|LPXA_PSEA7 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Gene Name=lpxA)