Structure of PDB 6uca Chain A

Receptor sequence

>6ucaA (length=413) Species: 9606 (Homo sapiens)

VLPLDPAVPAPLCPHGPTLLFVKVTQGAAATRRFYACSACRDRKDCNFFQ
WEDEKLSGARLAAREAHNRRCQPPLSRTQCVERYLKFIELPLTQRKFCQT
CQQLLLPDDWGQHSEHQVLGNVSITQLRRPSQLLYPLENAATNAQYLFAD
RSCQFLVDLLSALGFRRVLCVGTPRLHELIKLTASGDKKSNIKSLLLDID
FRYSQFYMEDSFCHYNMFNHHFFDGKTALEVCRAFLQEDKGEGIIMVTDP
PFGGLVEPLAITFKKLIAMWKEGQSQDDSHKELPIFWIFPYFFESRICQF
FPSFQMLDYQVDYDNHALYKHGKTGRKQSPVRIFTNIPPNKIILPTEEGY
RFCSPCQRYVSLENQHCELCNSCTSKDGRKWNHCFLCKKCVKPSWIHCSI
CNHCAVPDHSCEG

3D structure

• PDB: 6uca Structure and regulation of ZCCHC4 in m6A-methylation of 28S rRNA.
• Chain: A
• Resolution: 3.103 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	N170 A171 Q172 Y173 L174 F175 G199 T200 P201 R202 D225 I226 Y242 N243 M244 F245 D276 P278	N143 A144 Q145 Y146 L147 F148 G172 T173 P174 R175 D198 I199 Y215 N216 M217 F218 D249 P251
BS02	ZN	A	H42 C73	H15 C46
BS03	ZN	A	C128 H140 H143	C101 H113 H116
BS04	ZN	A	C380 H393 C400	C353 H366 C373
BS05	ZN	A	C394 H410 C417	C367 H383 C390
BS06	ZN	A	C411 C414 H424 C431	C384 C387 H397 C404
BS07	ZN	A	C425 C428 H436 C438	C398 C401 H409 C411

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008168 methyltransferase activity
• GO:0008270 zinc ion binding
• GO:0008988 rRNA (adenine-N6-)-methyltransferase activity

Biological Process

• GO:0031167 rRNA methylation
• GO:0032259 methylation

External links

• PDB: RCSB:6uca, PDBe:6uca, PDBj:6uca
• PDBsum: 6uca
• PubMed: 31695039
• UniProt: Q9H5U6|ZCHC4_HUMAN rRNA N6-adenosine-methyltransferase ZCCHC4 (Gene Name=ZCCHC4)