Structure of PDB 6ua4 Chain A

Receptor sequence

>6ua4A (length=488) Species: 9606 (Homo sapiens)

SYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY
EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISS
RDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRL
DLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVVTAAQA
KNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKK
YRGMGSLDAMIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSL
TQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

3D structure

• PDB: 6ua4 Cryo-EM structures demonstrate human IMPDH2 filament assembly tunes allosteric regulation.
• Chain: A
• Resolution: 3.65 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K57 R355 R356 T477 R480	K47 R345 R346 T451 R454
BS02	GTP	A	K109 Q112 F139 C140 S160 A223 T225	K99 Q102 F129 C130 S150 A213 T215
BS03	GTP	A	L194 K195 N198 D226 L227 N230 K242	L184 K185 N188 D216 L217 N220 K232
BS04	ATP	A	S159 S160 R161 D162 T180 L185 V186 K206 K208	S149 S150 R151 D152 T170 L175 V176 K196 K198
BS05	IMP	A	S68 M70 R322 G328 S329 I330 C331 D364 G365 G387 S388 Y411 G413 M414 G415 Q441	S58 M60 R312 G318 S319 I320 C321 D354 G355 G377 S378 Y401 G403 M404 G405 Q415
BS06	NAD	A	H253 D274 S275 S276 F282 N303 G415 Q441	H243 D264 S265 S266 F272 N293 G405 Q415

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006177 GMP biosynthetic process
• GO:0006183 GTP biosynthetic process
• GO:0007623 circadian rhythm
• GO:0046651 lymphocyte proliferation
• GO:0071353 cellular response to interleukin-4
• GO:0097294 'de novo' XMP biosynthetic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005778 peroxisomal membrane
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:6ua4, PDBe:6ua4, PDBj:6ua4
• PDBsum: 6ua4
• PubMed: 31999252
• UniProt: P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 (Gene Name=IMPDH2)