Structure of PDB 6ty0 Chain A |
>6ty0A (length=97) Species: 31744 (Rice yellow mottle virus) [Search protein sequence] |
MTRLEVLIRPTEQTAAKANAVGYTHALTWVWHSQTWDVDSVRDPSLRADF NPEKVGWVSVSFACTQCTAHYYTSEQVKYFTNIPPVHFDVVCADCER |
|
PDB | 6ty0 A Flexible and Original Architecture of Two Unrelated Zinc Fingers Underlies the Role of the Multitask P1 in RYMV Spread. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C64 C67 C92 C95 |
C64 C67 C92 C95 |
|
|
|