Structure of PDB 6tx5 Chain A |
>6tx5A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] |
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLS NGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYA YGSAGSLPKIPSNATLFFEIELLDFKGE |
|
PDB | 6tx5 Hybrid Screening Approach for Very Small Fragments: X-ray and Computational Screening on FKBP51. |
Chain | A |
Resolution | 1.08 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4MZ |
A |
D68 W90 Y113 |
D56 W78 Y101 |
MOAD: Kd=2.9nM BindingDB: Kd=2900000nM |
|
|
|