Structure of PDB 6tnh Chain A

Receptor sequence

>6tnhA (length=345) Species: 1076759 (Vibrio phage phiVC8)

SHMENVDLVIDLQFGSTGKGLIAGYLAEKNGYDTVINANMPNAGHTYINA
EGRKWMHKVLPNGIVSPNLKRVMLGAGSVFSINRLMEEIEMSKDLLHDKV
AILIHPMATVLDEEAHKKAEVGIATSIGSTGQGSMAAMVEKLQRDPTNNT
IVARDVAQYDGRIAQYVCTVEEWDMALMASERILAEGAQGFSLSLNQEFY
PYCTSRDCTPARFLADMGIPLPMLNKVIGTARCHPIRVGGTSGGHYPDQE
ELTWEQLGQVPELTTVTKKVRRVFSFSFIQMQKAMWTCQPDEVFLNFCNY
LSPMGWQDIVHQIEVAAQSRYCDAEVKYLGFGPTFNDVELREDVM

3D structure

• PDB: 6tnh A third purine biosynthetic pathway encoded by aminoadenine-based viral DNA genomes.
• Chain: A
• Resolution: 2.21 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S14 K17 G42 H43 Q187
• Catalytic site (residue number reindexed from 1): S16 K19 G44 H45 Q189
• Enzyme Commision number: 6.3.4.25: 2-amino-2'-deoxyadenylo-succinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DGP	A	N40 A41 S127 T128 Q187 L191 C201 T202 V236	N42 A43 S129 T130 Q189 L193 C203 T204 V238
BS02	ACP	A	G13 S14 G16 K17 G18 A41 G42 H43 T44 Q187 N294 F295 N297 G330 P331	G15 S16 G18 K19 G20 A43 G44 H45 T46 Q189 N296 F297 N299 G332 P333
BS03	ASP	A	T262 T263 V264	T264 T265 V266

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004019 adenylosuccinate synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0044208 'de novo' AMP biosynthetic process
• GO:0046040 IMP metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6tnh, PDBe:6tnh, PDBj:6tnh
• PDBsum: 6tnh
• PubMed: 33926955
• UniProt: G3FFN6|PURZ_BPVC8 N6-succino-2-amino-2'-deoxyadenylate synthase (Gene Name=purZ)