Structure of PDB 6tlo Chain A

Receptor sequence

>6tloA (length=333) Species: 9606 (Homo sapiens) [Search protein sequence]

SGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYS
EVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIV
KDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMG
IMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE
LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT
EDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFL
DKLLRYDHQSRLTAREAMEHPYFYTVVKDQARM

3D structure

PDB

6tlo Halogen Atoms in the Protein-Ligand System. Structural and Thermodynamic Studies of the Binding of Bromobenzotriazoles by the Catalytic Subunit of Human Protein Kinase CK2.

Chain

Resolution

1.69 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D156 K158 N161 D175 S194
Catalytic site (residue number reindexed from 1)	D155 K157 N160 D174 S193
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NKB	A	R47 V53 V66 K68 I95 F113 V116 I174 D175	R46 V52 V65 K67 I94 F112 V115 I173 D174
BS02	NKB	A	Q36 Y39 L41 I69	Q35 Y38 L40 I68

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016301	kinase activity
GO:0042802	identical protein binding
GO:0044024	histone H2AS1 kinase activity
GO:0051879	Hsp90 protein binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006302	double-strand break repair
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0006915	apoptotic process
GO:0006974	DNA damage response
GO:0007165	signal transduction
GO:0008284	positive regulation of cell population proliferation
GO:0016055	Wnt signaling pathway
GO:0016310	phosphorylation
GO:0017148	negative regulation of translation
GO:0018105	peptidyl-serine phosphorylation
GO:0018107	peptidyl-threonine phosphorylation
GO:0030177	positive regulation of Wnt signaling pathway
GO:0030307	positive regulation of cell growth
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045732	positive regulation of protein catabolic process
GO:0048511	rhythmic process
GO:0050821	protein stabilization
GO:0051726	regulation of cell cycle
GO:0061077	chaperone-mediated protein folding
GO:0075342	symbiont-mediated disruption of host cell PML body
GO:1905337	positive regulation of aggrephagy
GO:1905818	regulation of chromosome separation
GO:2000042	negative regulation of double-strand break repair via homologous recombination
GO:2001234	negative regulation of apoptotic signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005956	protein kinase CK2 complex
GO:0016605	PML body
GO:0031519	PcG protein complex
GO:0070822	Sin3-type complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6tlo, PDBe:6tlo, PDBj:6tlo
PDBsum	6tlo
PubMed	33689348
UniProt	P68400\|CSK21_HUMAN Casein kinase II subunit alpha (Gene Name=CSNK2A1)

[Back to BioLiP]