Structure of PDB 6tj1 Chain A |
>6tj1A (length=71) Species: 32630 (synthetic construct) [Search protein sequence] |
RGSHMTEDEIRKLRKLLEEAEKKLYKLEDKTRRSEEISDDPKAQSLQLIA ESLMLIAESLLIIAISLLLSS |
|
PDB | 6tj1 Computational design of transmembrane pores. |
Chain | A |
Resolution | 2.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
I5 R6 E13 |
I10 R11 E18 |
|
|
|