Structure of PDB 6t83 Chain A

Receptor sequence

>6t83A (length=175) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: A
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R3 Y4 R18 Y21 S25 F26 K27 R30 Q34 N37 Q55 R62 S65 S66 I67 R69 A71 Q72 K74 K80 R82 W83 P84 K86 N97 A100 N101 H116 Q118 V119 Q121 K124 R127 T129 Y130 R131 A132 H133 G134 R135 I136 K138 Y139 E140 S141 S142 L168 T169 S170 R171 Q172 G174 R175 I182	R2 Y3 R17 Y20 S24 F25 K26 R29 Q33 N36 Q54 R61 S64 S65 I66 R68 A70 Q71 K73 K79 R81 W82 P83 K85 N96 A99 N100 H115 Q117 V118 Q120 K123 R126 T128 Y129 R130 A131 H132 G133 R134 I135 K137 Y138 E139 S140 S141 L159 T160 S161 R162 Q163 G165 R166 I173
BS02	rna	A	R3 Y4 G5 R61 R62 Q118 N120	R2 Y3 G4 R60 R61 Q117 N119

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t83, PDBe:6t83, PDBj:6t83
• PDBsum: 6t83
• PubMed: 31858614
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)