Structure of PDB 6t58 Chain A

Receptor sequence

>6t58A (length=524) Species: 9606 (Homo sapiens) [Search protein sequence]

ETFSDLWKLLPENNPSQAMDDLMLSPDDIEQWFCPLEKALDVMVSTFHKY
SGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNE
VDFQEYCVFLSCIAMMCNEACPLEKALDVMVSTFHKYSGKEGDKFKLNKS
ELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCI
AMMCNEFFEGFTSAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN
EQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELK
ASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSG
DFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWIS
IMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQN
KPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSL
YYYIQQDTKGDYQKALLYLCGGDD

3D structure

PDB

6t58 Structure Determination of the Transactivation Domain of p53 in Complex with S100A4 Using Annexin A2 as a Crystallization Chaperone.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	D124 N126 D128 E130 E135	D94 N96 D98 E100 E105
BS02	CA	A	G428 R431 K432 G433 E473	G387 R390 K391 G392 E432
BS03	CA	A	G276 V277 E279	G235 V236 E238
BS04	CA	A	M344 G346 L347 G348 D388	M303 G305 L306 G307 D347
BS05	CA	A	D222 S223 N224 R225 D226 E233	D181 S182 N183 R184 D185 E192
BS06	CA	A	T349 E351	T308 E310
BS07	CA	A	E182 G183 D184 K187 N189 E192	E141 G142 D143 K146 N148 E151
BS08	CA	A	M504 G506 G508 D548	M463 G465 G467 D507
BS09	CA	A	K314 L317 E322	K273 L276 E281
BS10	CA	A	S81 E84 D86 K89 E94	S51 E54 D56 K59 E64

Gene Ontology

	Molecular Function
GO:0001786	phosphatidylserine binding
GO:0002020	protease binding
GO:0003723	RNA binding
GO:0003779	actin binding
GO:0004859	phospholipase inhibitor activity
GO:0004867	serine-type endopeptidase inhibitor activity
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0005544	calcium-dependent phospholipid binding
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding
GO:0008092	cytoskeletal protein binding
GO:0019834	phospholipase A2 inhibitor activity
GO:0042056	chemoattractant activity
GO:0042802	identical protein binding
GO:0044548	S100 protein binding
GO:0046872	metal ion binding
GO:0046914	transition metal ion binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding
GO:0098641	cadherin binding involved in cell-cell adhesion

	Biological Process
GO:0001525	angiogenesis
GO:0001765	membrane raft assembly
GO:0001837	epithelial to mesenchymal transition
GO:0001921	positive regulation of receptor recycling
GO:0002091	negative regulation of receptor internalization
GO:0006900	vesicle budding from membrane
GO:0007155	cell adhesion
GO:0007160	cell-matrix adhesion
GO:0010756	positive regulation of plasminogen activation
GO:0014823	response to activity
GO:0030199	collagen fibril organization
GO:0030324	lung development
GO:0031340	positive regulation of vesicle fusion
GO:0032804	negative regulation of low-density lipoprotein particle receptor catabolic process
GO:0036035	osteoclast development
GO:0042730	fibrinolysis
GO:0042789	mRNA transcription by RNA polymerase II
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0044090	positive regulation of vacuole organization
GO:0045921	positive regulation of exocytosis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050767	regulation of neurogenesis
GO:0050918	positive chemotaxis
GO:0098609	cell-cell adhesion
GO:1904019	epithelial cell apoptotic process
GO:1905581	positive regulation of low-density lipoprotein particle clearance
GO:1905597	positive regulation of low-density lipoprotein particle receptor binding
GO:1905599	positive regulation of low-density lipoprotein receptor activity
GO:1905602	positive regulation of receptor-mediated endocytosis involved in cholesterol transport
GO:1905686	positive regulation of plasma membrane repair

	Cellular Component
GO:0001533	cornified envelope
GO:0005576	extracellular region
GO:0005604	basement membrane
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005769	early endosome
GO:0005811	lipid droplet
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0009986	cell surface
GO:0012506	vesicle membrane
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016363	nuclear matrix
GO:0030496	midbody
GO:0031902	late endosome membrane
GO:0031982	vesicle
GO:0035578	azurophil granule lumen
GO:0035749	myelin sheath adaxonal region
GO:0042383	sarcolemma
GO:0042470	melanosome
GO:0043220	Schmidt-Lanterman incisure
GO:0045121	membrane raft
GO:0048471	perinuclear region of cytoplasm
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0090575	RNA polymerase II transcription regulator complex
GO:0098797	plasma membrane protein complex
GO:1990665	AnxA2-p11 complex
GO:1990667	PCSK9-AnxA2 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t58, PDBe:6t58, PDBj:6t58
PDBsum	6t58
PubMed	32442400
UniProt	P04637\|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53); P07355\|ANXA2_HUMAN Annexin A2 (Gene Name=ANXA2); P26447\|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]