Structure of PDB 6t36 Chain A

Receptor sequence

>6t36A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]

DSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRINPESPADTCIPKLN
EGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRR

3D structure

PDB

6t36 Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.

Chain

Resolution

1.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

3.1.3.48: protein-tyrosine-phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K520 F521 F523 N524 L525 K526 D530 Q531 S538 H572 D573	K16 F17 F19 N20 L21 K22 D26 Q27 S34 H68 D69

Gene Ontology

	Molecular Function
GO:0001784	phosphotyrosine residue binding
GO:0004721	phosphoprotein phosphatase activity
GO:0004725	protein tyrosine phosphatase activity
GO:0005515	protein binding
GO:0008092	cytoskeletal protein binding
GO:0017080	sodium channel regulator activity
GO:0051117	ATPase binding

	Biological Process
GO:0000165	MAPK cascade
GO:0006470	protein dephosphorylation
GO:0016311	dephosphorylation
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway
GO:0045930	negative regulation of mitotic cell cycle
GO:0051045	negative regulation of membrane protein ectodomain proteolysis
GO:0097421	liver regeneration
GO:0098902	regulation of membrane depolarization during action potential
GO:2000649	regulation of sodium ion transmembrane transporter activity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0009898	cytoplasmic side of plasma membrane

External links

PDB	RCSB:6t36, PDBe:6t36, PDBj:6t36
PDBsum	6t36
PubMed	33441627
UniProt	P26045\|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 (Gene Name=PTPN3)