Structure of PDB 6ssc Chain A |
>6sscA (length=149) Species: 36845 (Clostridium intestinale) [Search protein sequence] |
TPKIVEVNYTWATPLSYNFNPNMIVYHHTVDNNMTPQKIDEIHKQRGWSG IGYHFYIRKDGTIYRGRPENAVGSHAPGVNARAFGIASEGNFNEEYVTPQ QMTSLIALSRYLMNKYNITDLKRHKDVRQTECPGNNFPFEEIKAKLNVK |
|
PDB | 6ssc Molecular Characterization of a Novel Lytic Enzyme LysC from Clostridium intestinale URNW and Its Antibacterial Activity Mediated by Positively Charged N -Terminal Extension. |
Chain | A |
Resolution | 1.21 Å |
3D structure |
|
|
Enzyme Commision number |
3.5.1.28: N-acetylmuramoyl-L-alanine amidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H50 H147 C155 |
H27 H124 C132 |
|
|
|
|