Structure of PDB 6sqs Chain A

Receptor sequence

>6sqsA (length=64) Species: 9685 (Felis catus)

PSFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPV
CRQPIQMIVLTYFP

3D structure

• PDB: 6sqs Structural basis for DNA damage-induced phosphoregulation of MDM2 RING domain.
• Chain: A
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C438 C441 C461 C464	C11 C14 C34 C37
BS02	ZN	A	H452 H457 C475 C478	H25 H30 C48 C51

Gene Ontology

Molecular Function

• GO:0042802 identical protein binding
• GO:0061630 ubiquitin protein ligase activity

Biological Process

• GO:0043066 negative regulation of apoptotic process
• GO:0051726 regulation of cell cycle

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:6sqs, PDBe:6sqs, PDBj:6sqs
• PDBsum: 6sqs
• PubMed: 32350255
• UniProt: Q7YRZ8|MDM2_FELCA E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)