Structure of PDB 6spw Chain A

Receptor sequence

>6spwA (length=327) Species: 9606 (Homo sapiens) [Search protein sequence]

GPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSE
VFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVK
DPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGI
MHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPEL
LVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTE
DLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLD
KLLRYDHQSRLTAREAMEHPYFYTVVK

3D structure

PDB

6spw Unexpected CK2 beta-antagonistic functionality of bisubstrate inhibitors targeting protein kinase CK2.

Chain

Resolution

1.599 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D156 K158 N161 D175 S194
Catalytic site (residue number reindexed from 1)	D154 K156 N159 D173 S192
Enzyme Commision number	2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	K77 R80 R155 D156 K158 L178 E187 Y188 N189 R191 V192 A193 S194 R195 K198	K75 R78 R153 D154 K156 L176 E185 Y186 N187 R189 V190 A191 S192 R193 K196
BS02	peptide	A	D266 P267 R268	D264 P265 R266
BS03	A0Z	A	G48 V53 V66 F113 V116 K158 M163 I174	G46 V51 V64 F111 V114 K156 M161 I172
BS04	A0Z	A	Y39 L41 T108	Y37 L39 T106
BS05	A0Z	A	D237 Y239 D240 D266 I272	D235 Y237 D238 D264 I270

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0016301	kinase activity
GO:0042802	identical protein binding
GO:0044024	histone H2AS1 kinase activity
GO:0051879	Hsp90 protein binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0006302	double-strand break repair
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0006915	apoptotic process
GO:0006974	DNA damage response
GO:0007165	signal transduction
GO:0008284	positive regulation of cell population proliferation
GO:0016055	Wnt signaling pathway
GO:0016310	phosphorylation
GO:0017148	negative regulation of translation
GO:0018105	peptidyl-serine phosphorylation
GO:0018107	peptidyl-threonine phosphorylation
GO:0030177	positive regulation of Wnt signaling pathway
GO:0030307	positive regulation of cell growth
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045732	positive regulation of protein catabolic process
GO:0048511	rhythmic process
GO:0050821	protein stabilization
GO:0051726	regulation of cell cycle
GO:0061077	chaperone-mediated protein folding
GO:0075342	symbiont-mediated disruption of host cell PML body
GO:1905337	positive regulation of aggrephagy
GO:1905818	regulation of chromosome separation
GO:2000042	negative regulation of double-strand break repair via homologous recombination
GO:2001234	negative regulation of apoptotic signaling pathway

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005956	protein kinase CK2 complex
GO:0016605	PML body
GO:0031519	PcG protein complex
GO:0070822	Sin3-type complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6spw, PDBe:6spw, PDBj:6spw
PDBsum	6spw
PubMed	32058103
UniProt	P68400\|CSK21_HUMAN Casein kinase II subunit alpha (Gene Name=CSNK2A1)

[Back to BioLiP]