Structure of PDB 6smk Chain A |
>6smkA (length=130) Species: 226185 (Enterococcus faecalis V583) [Search protein sequence] |
GAFAPHFGSPFVRTSDYGKRPGLYGDFHTGIDYAAPTGTPIPAQYPGLVD WVQSSSIGLGEHVGIKVADNLWAMYGHMSRIRAKMGDKVKAGQIVGDVGS SGWSTGPAVHYELRKGGPNGQHVNPDTYGG |
|
PDB | 6smk Structural Characterization of EnpA D,L-Endopeptidase from Enterococcus faecalis Prophage Provides Insights into Substrate Specificity of M23 Peptidases. |
Chain | A |
Resolution | 2.997 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H29 D33 H111 |
H28 D32 H110 |
|
|
|