Structure of PDB 6sk8 Chain A

Receptor sequence

>6sk8A (length=392) Species: 9606 (Homo sapiens)

GQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYT
LPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWAL
RPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVH
KKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSL
NPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQ
LLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFY
TLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFN
ALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGL

3D structure

• PDB: 6sk8 High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: A
• Resolution: 1.87 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D183 F188 F190 G284 Y296 H298 F311 Y401 Y420 I469 G470 D471 G472	D82 F87 F89 G183 Y195 H197 F210 Y300 Y319 I368 G369 D370 G371
BS02	MYA	A	R115 Y117 Q118 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 T268 V271 Q278 A279 Y281 T282 L287 Y479	R14 Y16 Q17 F18 W19 Y79 V80 I144 L147 V149 R154 S155 R157 A159 T167 V170 Q177 A178 Y180 T181 L186 Y378

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6sk8, PDBe:6sk8, PDBj:6sk8
• PDBsum: 6sk8
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)