Structure of PDB 6sk3 Chain A

Receptor sequence

>6sk3A (length=387) Species: 9606 (Homo sapiens)

GPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLP
QGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRP
PGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKK
LRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNP
RKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLL
TRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTL
PSTIMNHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLM
ENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGL

3D structure

• PDB: 6sk3 High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Y180 E182 D183 F188 F190 N246 T282 R295 H298 F311 Y401 S405 I469 G470 D471 G472 N473	Y77 E79 D80 F85 F87 N143 T179 R192 H195 F208 Y298 S302 I363 G364 D365 G366 N367
BS02	MYA	A	Y117 F119 W120 Y180 V181 I245 L248 C249 V250 R255 S256 R258 A260 I264 T268 V271 F277 A279 Y281 T282 L287 Y479	Y14 F16 W17 Y77 V78 I142 L145 C146 V147 R152 S153 R155 A157 I161 T165 V168 F174 A176 Y178 T179 L184 Y373

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6sk3, PDBe:6sk3, PDBj:6sk3
• PDBsum: 6sk3
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)