Structure of PDB 6s8l Chain A

Receptor sequence

>6s8lA (length=424) Species: 9606 (Homo sapiens)

RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTI
GKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD
YGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDALNVDLTEFQTNLVP
YPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGK
YMACCLLYRGDVVPKDVNAAIATIKTKSIQFVDWCPTGFKVGINYQPPTV
VPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG
MEEGEFSEAREDMAALEKDYEEVG

3D structure

• PDB: 6s8l Structure, Thermodynamics, and Kinetics of Plinabulin Binding to Two Tubulin Isotypes
• Chain: A
• Resolution: 1.801 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G10 Q11 A12 Q15 A99 N101 S140 G143 G144 T145 G146 E183 N206 Y224 N228	G9 Q10 A11 Q14 A89 N91 S130 G133 G134 T135 G136 E173 N196 Y214 N218

Gene Ontology

Molecular Function

• GO:0003725 double-stranded RNA binding
• GO:0003924 GTPase activity
• GO:0005198 structural molecule activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0030705 cytoskeleton-dependent intracellular transport
• GO:0051301 cell division
• GO:0071353 cellular response to interleukin-4

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0005881 cytoplasmic microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:6s8l, PDBe:6s8l, PDBj:6s8l
• PDBsum: 6s8l
• UniProt: P68363|TBA1B_HUMAN Tubulin alpha-1B chain (Gene Name=TUBA1B)