Structure of PDB 6s7m Chain A |
>6s7mA (length=67) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] |
MWHTHSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICEAF TKVGQPKTLNEIKRILS |
|
PDB | 6s7m Structure of parasitic PEX14 in complex with a benzo[b]thiophene-7-carboxylic acid. |
Chain | A |
Resolution | 1.75846 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
KZ2 |
A |
K36 A42 K62 |
K37 A43 K63 |
|
|
|
|