Structure of PDB 6s6r Chain A |
>6s6rA (length=69) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] |
GAMWHTHSEREKRVSNAVEFLLDSRVRRTPTSSKVHFLKSKGLSAEEICE AFTKVGQPKTLNEIKRILS |
|
PDB | 6s6r First crystal structure of parasitic PEX14 in complex with a fragment molecule 1H-indole-7-carboxylic acid |
Chain | A |
Resolution | 1.58001 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
KXQ |
A |
F17 D20 F34 |
F20 D23 F37 |
|
|
|
|