Structure of PDB 6s48 Chain A

Receptor sequence

>6s48A (length=235) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]

KFIQNAAEIAKKAMDSVDPSLSEKFTIVIRFLTDNPDAASALKGKERSIV
GTEEYIIASATNFKKGRDPRTPLPPSTIPDEMVSVILNKYFEVPSEELEK
AEEWHRLSMGAENIVGDLLERYIAEVIEPHGWIWCSGSMVRAVDFIYCDS
ENVWQSLQVKNRDNTENSSSAAIRHGTPIKKWFRTFSKKRGDNWDKFPSL
EGKENLSEKGFKLYVEKYLSALRAIKALEHHHHHH

3D structure

PDB

6s48 Restriction endonucleases that cleave RNA/DNA heteroduplexes bind dsDNA in A-like conformation.

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	S43 E115 N116 G119 K163 N164 R165 N167 T168	S40 E112 N113 G116 K160 N161 R162 N164 T165
BS02	dna	A	N170 S171	N167 S168
BS03	dna	A	K46 K68 R73 P78 T80 M112 N116 N170	K43 K65 R70 P75 T77 M109 N113 N167
BS04	dna	A	N170 S171	N167 S168
BS05	dna	A	K46 K68 R73 P78 T80 M112 N116 N170	K43 K65 R70 P75 T77 M109 N113 N167
BS06	dna	A	S43 A44	S40 A41
BS07	dna	A	E115 N116 G119 Q161 K163 N164 R165 N167 T168	E112 N113 G116 Q158 K160 N161 R162 N164 T165
BS08	CA	A	D147 Q161 V162	D144 Q158 V159
BS09	CA	A	E123 D147	E120 D144

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0009036	type II site-specific deoxyribonuclease activity
GO:0046872	metal ion binding

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6s48, PDBe:6s48, PDBj:6s48
PDBsum	6s48
PubMed	32459314
UniProt	Q8YYB7

[Back to BioLiP]