Structure of PDB 6s07 Chain A

Receptor sequence

>6s07A (length=303) Species: 471852 (Thermomonospora curvata DSM 43183)

HMPSFDFDIPRRSPQEIAKGMVAIPGGTFRMGGEDPDAFPEDGEGPVRTV
RLSPFLIDRYAVSNRQFAAFVKATGYVTDAERYGWSFVFHAHVAPGTPVM
DAVVPEAPWWVAVPGAYWKAPEGPGSSITDRPNHPVVHVSWNDAVAYATW
AGKRLPTEAEWEMAARGGLDQARYPWGNELTPRGRHRCNIWQGTFPVHDT
GEDGYTGTAPVNAFAPNGYGLYNVAGNVWEWCADWWSADWHATESPATRI
DPRGPETGTARVTKGGSFLCHESYCNRYRVAARTCNTPDSSAAHTGFRCA
ADP

3D structure

• PDB: 6s07 Structure of formylglycine-generating enzyme in complex with copper and a substrate reveals an acidic pocket for binding and activation of molecular oxygen.
• Chain: A
• Resolution: 1.04 Å

Enzymatic activity

• Enzyme Commision number: 1.8.3.7: formylglycine-generating enzyme.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F38 E40 A79 Y82 W84 F86 V102 P104 W109 W228 Y273 C274 R276 N285 D288 S289 H293	F39 E41 A80 Y83 W85 F87 V103 P105 W110 W229 Y274 C275 R277 N286 D289 S290 H294
BS02	CU1	A	C269 C274	C270 C275
BS03	CA	A	N222 V223 G225 V227 E229 G264	N223 V224 G226 V228 E230 G265
BS04	CA	A	N188 I189 D202 Y204	N189 I190 D203 Y205

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0120147 formylglycine-generating oxidase activity
• GO:1903136 cuprous ion binding

Biological Process

• GO:0018158 protein oxidation
• GO:0043687 post-translational protein modification

External links

• PDB: RCSB:6s07, PDBe:6s07, PDBj:6s07
• PDBsum: 6s07
• PubMed: 31588272
• UniProt: D1A7C3|FGE_THECD Formylglycine-generating enzyme (Gene Name=Tcur_4811)