Structure of PDB 6rxn Chain A

Receptor sequence
>6rxnA (length=45) Species: 876 (Desulfovibrio desulfuricans) [Search protein sequence]
MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
3D structure
PDB6rxn The structure of rubredoxin from Desulfovibrio desulfuricans strain 27774 at 1.5 A resolution.
ChainA
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE A C6 C9 C39 C42 C6 C9 C32 C35
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Biological Process
GO:0043448 alkane catabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rxn, PDBe:6rxn, PDBj:6rxn
PDBsum6rxn
PubMed2091025
UniProtP04170|RUBR1_DESDA Rubredoxin-1 (Gene Name=rd1)

[Back to BioLiP]