Structure of PDB 6rvh Chain A

Receptor sequence

>6rvhA (length=443) Species: 274 (Thermus thermophilus)

MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVL
SGEIPRLERLVARTPEEFRKQGVLVHTRHEVVDVDYELRTLTVHDHAEGR
TFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGERLLKALPQAR
RAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEEL
ERHGVEVWTGVKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELA
QAMGVALGPTGAIATDERMRTNLEGVYAAGDVAESFHRVLKRPYWLPLGD
VANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALR
IDVLAALLHREGSVEDLLALDLAYAPPFSPVWDPLLIAAQQAR

3D structure

• PDB: 6rvh Characterization and X-ray structure of the NADH-dependent coenzyme A disulfide reductase from Thermus thermophilus.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V39 C44 E53 E58 Y159 E163 A425 P430
• Catalytic site (residue number reindexed from 1): V39 C44 E53 E58 Y159 E163 A425 P430
• Enzyme Commision number: 1.6.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	V8 V11 A12 G13 E34 K35 A43 C44 V81 T113 G114 R134 Y159 G280 D281 P297 L298 G299	V8 V11 A12 G13 E34 K35 A43 C44 V81 T113 G114 R134 Y159 G280 D281 P297 L298 G299
BS02	COA	A	K20 R23 S40 Y41 C44 R63 N303 R307	K20 R23 S40 Y41 C44 R63 N303 R307
BS03	VK3	A	A364 H365 P430 V431	A364 H365 P430 V431
BS04	FAD	A	Y424 A425	Y424 A425
BS05	COA	A	Q359 V431 I437 Q441 A442	Q359 V431 I437 Q441 A442

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity

External links

• PDB: RCSB:6rvh, PDBe:6rvh, PDBj:6rvh
• PDBsum: 6rvh
• PubMed: 31520616
• UniProt: Q72HK3