Structure of PDB 6rup Chain A |
>6rupA (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] |
VLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSQLGDVSQ KTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQAT TIIADNIIFLS |
|
PDB | 6rup Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
V78 S79 Q80 |
V48 S49 Q50 |
|
|
|
|