Structure of PDB 6rup Chain A

Receptor sequence
>6rupA (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]
VLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSQLGDVSQ
KTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQAT
TIIADNIIFLS
3D structure
PDB6rup Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A V78 S79 Q80 V48 S49 Q50
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003697 single-stranded DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006260 DNA replication
GO:0006264 mitochondrial DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0007005 mitochondrion organization
GO:0051096 positive regulation of helicase activity
GO:0051289 protein homotetramerization
GO:0090297 positive regulation of mitochondrial DNA replication
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0042645 mitochondrial nucleoid
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rup, PDBe:6rup, PDBj:6rup
PDBsum6rup
PubMed31550237
UniProtQ04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial (Gene Name=SSBP1)

[Back to BioLiP]