Structure of PDB 6rsx Chain A

Receptor sequence

>6rsxA (length=266) Species: 3039 (Euglena gracilis)

VKKQLNPETKARIEKCLRGNILFRSLGEDSLEVVYSSMFEKTAEAGHFIM
KQYDEGDNFYVIESGTCNILIQPNPDAEPVHKSTIGPGASFGELALMYGT
PRAASVQAVSNVRLWALDRDTFRRILLTQTMRKRRQYEDFLAQVPLFEAL
TSYERMTMADALQPCTFKDKEIVVKEGEDGGSFYIIIDGKMKVNQTLNGR
IHTINILGPKDFFGEMSLMFNQPCVATVVSEGVSHCVSLDRESFTALLGP
MEEILQRNMQNYSAPR

3D structure

• PDB: 6rsx Regulatory Subunit of Protein Kinase A (cAMP-dependent) from Euglena gracilis at 1.6 A resolution
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CMP	A	M180 I199 I201 F221 G222 E223 L224 A225 R232 A233 A234 Y283	M50 I69 I71 F91 G92 E93 L94 A95 R102 A103 A104 Y153
BS02	CMP	A	V323 I334 N335 F343 G344 E345 M346 S347 C354 V355 Y392	V193 I204 N205 F213 G214 E215 M216 S217 C224 V225 Y262

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 22:26:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6rsx', asym_id = 'A', title = 'Regulatory Subunit of Protein Kinase A (cAMP-dependent) from Euglena gracilis at 1.6 A resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6rsx', asym_id='A', title='Regulatory Subunit of Protein Kinase A (cAMP-dependent) from Euglena gracilis at 1.6 A resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0001932,0005952,0008603', uniprot = '', pdbid = '6rsx', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0001932,0005952,0008603', uniprot='', pdbid='6rsx', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>