Structure of PDB 6rkm Chain A

Receptor sequence

>6rkmA (length=229) Species: 9606 (Homo sapiens) [Search protein sequence]

GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLS
VAYKNVVGGQRAAWRVLSSIEQKSNGPEVREYREKVETELQGVCDTVLGL
LDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQ
EAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAM
ADLHTLSEDSYKDSTLIMQLLRDNLTLWT

3D structure

PDB

6rkm Fragment-based Differential Targeting of PPI Stabilizer Interfaces.

Chain

Resolution

1.88 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K49 N50 G53 R56 R60 K122 R129 Y130 L174 N175 V178 Y181 E182 D225 N226 W230	K54 N55 G58 R61 R65 K120 R127 Y128 L172 N173 V176 Y179 E180 D223 N224 W228
BS02	K6Z	A	E14 E39 N42 L43	E19 E44 N47 L48
BS03	K6Z	A	D97 Y128 D139 I143	D95 Y126 D137 I141

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008426	protein kinase C inhibitor activity
GO:0019901	protein kinase binding
GO:0042802	identical protein binding
GO:0045296	cadherin binding
GO:0050815	phosphoserine residue binding
GO:0051219	phosphoprotein binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001836	release of cytochrome c from mitochondria
GO:0003334	keratinocyte development
GO:0006469	negative regulation of protein kinase activity
GO:0006611	protein export from nucleus
GO:0007165	signal transduction
GO:0008104	protein localization
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010482	regulation of epidermal cell division
GO:0010839	negative regulation of keratinocyte proliferation
GO:0022407	regulation of cell-cell adhesion
GO:0030216	keratinocyte differentiation
GO:0030307	positive regulation of cell growth
GO:0031424	keratinization
GO:0032880	regulation of protein localization
GO:0043588	skin development
GO:0043616	keratinocyte proliferation
GO:0045606	positive regulation of epidermal cell differentiation
GO:0045785	positive regulation of cell adhesion
GO:0045824	negative regulation of innate immune response
GO:0046827	positive regulation of protein export from nucleus
GO:0051726	regulation of cell cycle
GO:0061436	establishment of skin barrier
GO:0072089	stem cell proliferation
GO:0141156	cAMP/PKA signal transduction
GO:1903077	negative regulation of protein localization to plasma membrane
GO:1903829	positive regulation of protein localization
GO:2000647	negative regulation of stem cell proliferation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6rkm, PDBe:6rkm, PDBj:6rkm
PDBsum	6rkm
PubMed	32501690
UniProt	P31947\|1433S_HUMAN 14-3-3 protein sigma (Gene Name=SFN)

[Back to BioLiP]