Structure of PDB 6rgi Chain A

Receptor sequence

>6rgiA (length=92) Species: 559292 (Saccharomyces cerevisiae S288C)

EFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSNVLWDE
NNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLKKATE

3D structure

• PDB: 6rgi Calixarene capture of partially unfolded cytochrome c.
• Chain: A
• Resolution: 2.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	R13 C14 C17 H18 G29 P30 L32 I35 M64 Y67 L68 Y74 A81 F82	R17 C18 C21 H22 G33 P34 L36 I39 M53 Y56 L57 Y63 A70 F71
BS02	FWQ	A	K73 A81 G83 K86	K62 A70 G72 K75
BS03	IMD	A	Y67 F82	Y56 F71

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:6rgi, PDBe:6rgi, PDBj:6rgi
• PDBsum: 6rgi
• PubMed: 31254353
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)