Structure of PDB 6r1q Chain A

Receptor sequence

>6r1qA (length=148) Species: 10090 (Mus musculus)

RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDG

3D structure

• PDB: 6r1q Gas-sensitive biological crystals processed in pressurized oxygen and krypton atmospheres: deciphering gas channels in proteins using a novel `soak-and-freeze' methodology
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 1.7.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	L38 L41 F42 Y44 H64 K67 V68 V71 L92 H96 V101	L36 L39 F40 Y42 H62 K65 V66 V69 L90 H94 V99
BS02	AR	A	F28 A29 F32 L56	F26 A27 F30 L54
BS03	AR	A	F28 V109	F26 V107
BS04	AR	A	G24 F28 V68 M69	G22 F26 V66 M67
BS05	AR	A	G110 L114 W133 Y137	G108 L112 W131 Y135
BS06	AR	A	K67 L70	K65 L68
BS07	AR	A	K95 H96 V99	K93 H94 V97
BS08	AR	A	L82 V140	L80 V138
BS09	AR	A	F106 M144	F104 M142
BS10	AR	A	F106 Y137	F104 Y135

Gene Ontology

Molecular Function

• GO:0005092 GDP-dissociation inhibitor activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0071456 cellular response to hypoxia

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol

External links

• PDB: RCSB:6r1q, PDBe:6r1q, PDBj:6r1q
• PDBsum: 6r1q
• UniProt: Q9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)