Structure of PDB 6r00 Chain A

Receptor sequence

>6r00A (length=384) Species: 72120 (Omphalotus olearius)

TKAGSLTIVGTGIESIGQMTLQALSYIEAAAKVFYCVIDPATEAFILTKN
KNCVDLYQYYDNGKSRLNTYTQMSELMVREVRKGLDVVGVFYGHPGVFVN
PSHRALAIAKSEGYRARMLPGVSAEDCLFADLCIDPSNPGCLTYEASDFL
IRDRPVSIHSHLVLFQVGCVGIADFNFTGFDNNKFGVLVDRLEQEYGAEH
PVVHYIAAMMPHQDPVTDKYTVAQLREPEIAKRVGGVSTFYIPPKARKAS
NLDIIRRLELLPAGQVPDKKARIYPANQWEPDVPEVEPYRPSDQAAIAQL
ADHAPPEQYQPLATSKAMSDVMTKLALDPKALADYKADHRAFAQSVPDLT
PQERAALELGDSWAIRCAMKNMPSSLLDAARESG

3D structure

• PDB: 6r00 Substrate Plasticity of a Fungal Peptide alpha-N-Methyltransferase.
• Chain: A
• Resolution: 1.74 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	I44 Y63 Y66 S71 R72 L73 Y76 Y98 F104 V105 N106 P107 E151 R158 Q172 G174 I178 A179 T184 G185 F186 G242	I38 Y57 Y60 S65 R66 L67 Y70 Y92 F98 V99 N100 P101 E145 R152 Q166 G168 I172 A173 T178 G179 F180 G236
BS02	SAH	A	Y98 G99 H100 V103 F104 S129 A130 F171 Q172 I212 A213 G242 V243 S244 T245	Y92 G93 H94 V97 F98 S123 A124 F165 Q166 I206 A207 G236 V237 S238 T239

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

Biological Process

• GO:0032259 methylation

External links

• PDB: RCSB:6r00, PDBe:6r00, PDBj:6r00
• PDBsum: 6r00
• PubMed: 32491837
• UniProt: A0A2R2JFI5|OPHMA_OMPOL Methyltransferase/ribosomally synthesized cyclic peptide omphalotin A precursor ophMA (Gene Name=ophMA)