Structure of PDB 6qzi Chain A

Receptor sequence

>6qziA (length=247) Species: 9606 (Homo sapiens) [Search protein sequence]

MVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGV
HVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYS
LFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGML
QLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLP
PRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGST

3D structure

PDB

6qzi Structural Basis for Glycerol Efflux and Selectivity of Human Aquaporin 7.

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GOL	A	G86 G90	G54 G58
BS02	GOL	A	F74 G222 Y223 A224 R229	F42 G190 Y191 A192 R197
BS03	GOL	A	L60 N61 A137 H140	L28 N29 A105 H108
BS04	GOL	A	G156 Y161	G124 Y129
BS05	GOL	A	V59 K62	V27 K30
BS06	GOL	A	G222 R229	G190 R197
BS07	GOL	A	S132 Y135	S100 Y103
BS08	GOL	A	R106 T190 D191	R74 T158 D159
BS09	GOL	A	V78 N94 V210	V46 N62 V178
BS10	GOL	A	A91 H92 N94 L182	A59 H60 N62 L150

Gene Ontology

	Molecular Function
GO:0015267	channel activity

	Biological Process
GO:0055085	transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qzi, PDBe:6qzi, PDBj:6qzi
PDBsum	6qzi
PubMed	31831212
UniProt	O14520\|AQP7_HUMAN Aquaporin-7 (Gene Name=AQP7)

[Back to BioLiP]