Structure of PDB 6qya Chain A

Receptor sequence

>6qyaA (length=278) Species: 1351 (Enterococcus faecalis)

MEEAYLALGKKILEEGHFKEDRTGTGTYSLFGYQMRFDLAKGFPLLTTKR
VPFGLIKSELLWFLKGDTNIRYLLERNNHIWDEWAFERYVKCDAILNFAE
KYGELGNIYGAQWRHWETKDGSFIDQLANVIEMIKTNPDSRRLIVSAWNP
EDVPSMALPPCHTMFQFYVNEGKLSCQLYQRSADVFLGVPFNIASYALLT
HLIAHETGLEVGEFVHTLGDAHLYQNHVEQMQEQLSREVRSFPTLVLNPD
KASVFDFDMEDIKVEGYDPHPTIKAPIA

3D structure

• PDB: 6qya Structural Comparison ofEnterococcus faecalisand Human Thymidylate Synthase Complexes with the Substrate dUMP and Its Analogue FdUMP Provides Hints about Enzyme Conformational Variabilities.
• Chain: A
• Resolution: 1.76 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E59 W81 Y145 C197 R217 D220
• Catalytic site (residue number reindexed from 1): E59 W81 Y109 C161 R181 D184
• Enzyme Commision number: 2.1.1.45: thymidylate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UMP	A	R22 C197 R217 S218 A219 D220 N228 H258 Y260	R22 C161 R181 S182 A183 D184 N192 H222 Y224

Gene Ontology

Molecular Function

• GO:0004799 thymidylate synthase activity
• GO:0008168 methyltransferase activity
• GO:0016741 transferase activity, transferring one-carbon groups

Biological Process

• GO:0006231 dTMP biosynthetic process
• GO:0006235 dTTP biosynthetic process
• GO:0009165 nucleotide biosynthetic process
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6qya, PDBe:6qya, PDBj:6qya
• PDBsum: 6qya
• PubMed: 30935102
• UniProt: Q834R3|TYSY_ENTFA Thymidylate synthase (Gene Name=thyA)