Structure of PDB 6qrm Chain A

Receptor sequence

>6qrmA (length=392) Species: 9606 (Homo sapiens)

PAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQ
GFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPP
GWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKL
RSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPR
KLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLT
RYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLP
STIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALD
LMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 6qrm High-resolution snapshots of human N-myristoyltransferase in action illuminate a mechanism promoting N-terminal Lys and Gly myristoylation.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D183 D185 F188 F190 T282 G284 Y296 H298 F311 S405 I469 G470 D471 G472 N473 Q496	D79 D81 F84 F86 T178 G180 Y192 H194 F207 S301 I365 G366 D367 G368 N369 Q392
BS02	COA	A	R115 Y117 Q118 F119 W120 Y180 V181 L248 C249 V250 R255 S256 R258 A260 P261 A283 L287	R11 Y13 Q14 F15 W16 Y76 V77 L144 C145 V146 R151 S152 R154 A156 P157 A179 L183

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:6qrm, PDBe:6qrm, PDBj:6qrm
• PDBsum: 6qrm
• PubMed: 32111831
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)