Structure of PDB 6qj7 Chain A

Receptor sequence

>6qj7A (length=338) Species: 9606 (Homo sapiens) [Search protein sequence]

ESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKH
KETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKD
NSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDL
IYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILS
KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFS
SDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

3D structure

PDB

6qj7 Difluorophenyl diacylhydrazides: Potent inhibitors of Serum- and Glucocorticoid-inducible Kinase 1 (SGK1)

Chain

Resolution

1.69 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D166 K168 N171 D184 T201
Catalytic site (residue number reindexed from 1)	D154 K156 N159 D172 T189
Enzyme Commision number	2.7.11.11: cAMP-dependent protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	Q84 E127 F129 R133 E170 F187 L198 G200 P202 E203 E230 Y235 P236 F239 D241 I246	Q72 E115 F117 R121 E158 F175 L186 G188 P190 E191 E218 Y223 P224 F227 D229 I234
BS02	J4B	A	G50 T51 G55 V57 A70 K72 E121 Y122 V123 L173 T183 D184 F327	G38 T39 G43 V45 A58 K60 E109 Y110 V111 L161 T171 D172 F315

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0004712	protein serine/threonine/tyrosine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0030145	manganese ion binding
GO:0031625	ubiquitin protein ligase binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0099103	channel activator activity
GO:0106310	protein serine kinase activity

	Biological Process
GO:0001707	mesoderm formation
GO:0001843	neural tube closure
GO:0002027	regulation of heart rate
GO:0003091	renal water homeostasis
GO:0006397	mRNA processing
GO:0006468	protein phosphorylation
GO:0006611	protein export from nucleus
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0010737	protein kinase A signaling
GO:0010881	regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0016241	regulation of macroautophagy
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0019221	cytokine-mediated signaling pathway
GO:0032024	positive regulation of insulin secretion
GO:0032703	negative regulation of interleukin-2 production
GO:0034380	high-density lipoprotein particle assembly
GO:0034605	cellular response to heat
GO:0035694	mitochondrial protein catabolic process
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045667	regulation of osteoblast differentiation
GO:0045722	positive regulation of gluconeogenesis
GO:0045879	negative regulation of smoothened signaling pathway
GO:0046827	positive regulation of protein export from nucleus
GO:0048240	sperm capacitation
GO:0050804	modulation of chemical synaptic transmission
GO:0050850	positive regulation of calcium-mediated signaling
GO:0051726	regulation of cell cycle
GO:0055117	regulation of cardiac muscle contraction
GO:0061136	regulation of proteasomal protein catabolic process
GO:0070417	cellular response to cold
GO:0070613	regulation of protein processing
GO:0071333	cellular response to glucose stimulus
GO:0071374	cellular response to parathyroid hormone stimulus
GO:0071377	cellular response to glucagon stimulus
GO:0071872	cellular response to epinephrine stimulus
GO:0086064	cell communication by electrical coupling involved in cardiac conduction
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:1903779	regulation of cardiac conduction
GO:1904262	negative regulation of TORC1 signaling
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:1990044	protein localization to lipid droplet
GO:2000810	regulation of bicellular tight junction assembly

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0005952	cAMP-dependent protein kinase complex
GO:0016607	nuclear speck
GO:0031410	cytoplasmic vesicle
GO:0031514	motile cilium
GO:0031594	neuromuscular junction
GO:0034704	calcium channel complex
GO:0036126	sperm flagellum
GO:0044853	plasma membrane raft
GO:0048471	perinuclear region of cytoplasm
GO:0070062	extracellular exosome
GO:0097546	ciliary base
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qj7, PDBe:6qj7, PDBj:6qj7
PDBsum	6qj7
PubMed
UniProt	P17612\|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=PRKACA)

[Back to BioLiP]