Structure of PDB 6qce Chain A

Receptor sequence

>6qceA (length=282) Species: 9606 (Homo sapiens)

PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTAS
GIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRF
LVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGL
KATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTS
LQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLM
KHLGLEIPAWDGPRVLERALPPLPRPPTPKLE

3D structure

• PDB: 6qce Structural basis for the activation and inhibition of Sirtuin 6 by quercetin and its derivatives.
• Chain: A
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P62 D63 F64 R65 N114 D116 H133
• Catalytic site (residue number reindexed from 1): P53 D54 F55 R56 N105 D107 H124
• Enzyme Commision number: 2.3.1.-
  2.3.1.286: protein acetyllysine N-acetyltransferase.
  2.4.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AR6	A	G52 G54 T57 D63 F64 R65 Q113 H133 G214 T215 S216 I219 N240 L241 Q242 Y257 V258	G43 G45 T48 D54 F55 R56 Q104 H124 G198 T199 S200 I203 N224 L225 Q226 Y241 V242
BS02	ZN	A	C141 C144 C166 C177	C132 C135 C157 C161
BS03	HW2	A	I61 P62 F64 V70 F82 M136 M157	I52 P53 F55 V61 F73 M127 M148

Gene Ontology

Molecular Function

• GO:0070403 NAD+ binding

External links

• PDB: RCSB:6qce, PDBe:6qce, PDBj:6qce
• PDBsum: 6qce
• PubMed: 31844103
• UniProt: Q8N6T7|SIR6_HUMAN NAD-dependent protein deacylase sirtuin-6 (Gene Name=SIRT6)