Structure of PDB 6q6b Chain A

Receptor sequence
>6q6bA (length=132) Species: 1200984 (Streptomyces lividans 1326) [Search protein sequence]
TVNDLLRTYPADLGGVDREAMARCIEECLRCAQACTACADACLSEPTVAD
LTKCIRTDMDCADVCTATAAVLSRHTGYDANVTRAVLQACATVCAACGDE
CARHAGMHEHCRVCAEACRSCEQACQELLAGL
3D structure
PDB6q6b A Histidine Residue and a Tetranuclear Cuprous-thiolate Cluster Dominate the Copper Loading Landscape of a Copper Storage Protein from Streptomyces lividans.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU1 A C57 C114 C54 C111
BS02 CU1 A C41 C104 C38 C101
BS03 CU1 A C41 C45 C38 C42
BS04 CU1 A C117 C121 C114 C118
BS05 CU1 A C34 C38 C31 C35
BS06 CU1 A C64 C68 C61 C65
BS07 CU1 A C38 C64 C100 C35 C61 C97
BS08 CU1 A C64 C121 C61 C118
BS09 CU1 A C124 C128 C121 C125
BS10 CU1 A C34 C97 C31 C94
BS11 CU1 A C93 C97 C90 C94
BS12 CU A H113 C114 H110 C111
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6q6b, PDBe:6q6b, PDBj:6q6b
PDBsum6q6b
PubMed31111982
UniProtQ9X8F4

[Back to BioLiP]