Structure of PDB 6q2u Chain A

Receptor sequence

>6q2uA (length=171) Species: 287 (Pseudomonas aeruginosa)

AGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDG
KRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRG
GKIAEGMPACTGCHSFPHLGGQHATYVAKQLTDFREGTRTNDGDTKIMQS
IAAKLSNKDIAAISSYIQGLH

3D structure

• PDB: 6q2u Structure and redox properties of the diheme electron carrier cytochrome c4from Pseudomonas aeruginosa.
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	V13 C14 C17 H18 F29 P30 L32 Y39 I47 R52 V54 M57 L60 Y136 K139 Q140	V13 C14 C17 H18 F29 P30 L32 Y39 I47 R52 V54 M57 L60 Y126 K129 Q130
BS02	HEC	A	Y39 K42 Q43 C110 C113 H114 P127 L129 Y136 L141 R149 N151 M158 I161	Y39 K42 Q43 C110 C113 H114 P117 L119 Y126 L131 R139 N141 M148 I151

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6q2u, PDBe:6q2u, PDBj:6q2u
• PDBsum: 6q2u
• PubMed: 31707335
• UniProt: P00106|CYC4_PSEAE Cytochrome c4 (Gene Name=cc4)