Structure of PDB 6q2p Chain A

Receptor sequence

>6q2pA (length=291) Species: 10090 (Mus musculus)

RTTPVSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKQAGLE
KINFSGGEPFLQDRGEYLGKLVRFCKEELALPSVSIVSNGSLIRERWFKD
YGEYLDILAISCDSFDEQVNALIGRGQGKKNHVENLQKLRRWCRDYKVAF
KINSVINRFNVDEDMNEHIKALSPVRWKVFQCLLIEGENSGADALRAAER
FLISNEEFETFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCTGGRK
DPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYVWSKADLKL

3D structure

• PDB: 6q2p Structural Basis of the Substrate Selectivity of Viperin.
• Chain: A
• Resolution: 1.452 Å

Enzymatic activity

• Enzyme Commision number: 4.2.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C84 Y86 C88 C91 G126 N158 R194	C15 Y17 C19 C22 G57 N89 R125
BS02	SAH	A	F90 F92 S124 G125 G126 E127 V156 S157 N158 S180 R194 N222 V224 L252 M298	F21 F23 S55 G56 G57 E58 V87 S88 N89 S111 R125 N153 V155 L183 M229
BS03	CTP	A	N77 H79 F92 K120 N122 S124 K220 N222 R245 K247 F249 Y302 I304 K319 Y351	N8 H10 F23 K51 N53 S55 K151 N153 R176 K178 F180 Y233 I235 K250 Y282

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0051536 iron-sulfur cluster binding

Biological Process

• GO:0051607 defense response to virus

Cellular Component

• GO:0005789 endoplasmic reticulum membrane
• GO:0005811 lipid droplet

External links

• PDB: RCSB:6q2p, PDBe:6q2p, PDBj:6q2p
• PDBsum: 6q2p
• PubMed: 31917549
• UniProt: Q8CBB9|RSAD2_MOUSE S-adenosylmethionine-dependent nucleotide dehydratase RSAD2 (Gene Name=Rsad2)