Structure of PDB 6px3 Chain A

Receptor sequence
>6px3A (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
3D structure
PDB6px3 Nucleosome and ubiquitin position Set2 to methylate H3K36.
ChainA
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 P43 G44 V46 R49 K56 R63 K64 L65 P66 R69 Y4 P6 G7 V9 R12 K19 R26 K27 L28 P29 R32
BS02 dna A R42 R72 R83 F84 R116 V117 T118 M120 R5 R35 R46 F47 R79 V80 T81 M83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6px3, PDBe:6px3, PDBj:6px3
PDBsum6px3
PubMed31439846
UniProtP02302|H3C_XENLA Histone H3.3C (Gene Name=h3-5)

[Back to BioLiP]