Structure of PDB 6pw1 Chain A

Receptor sequence

>6pw1A (length=534) Species: 272943 (Cereibacter sphaeroides 2.4.1)

FTRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFMCAE
HLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIPALF
GGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGNGQL
GSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMR
APGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQP
SGGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPM
VYAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKIFSW
IATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDTYYV
VAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVGANL
TFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIF
YTLTRGARVTANNYWNEHADTLEWTLTSPPPEHT

3D structure

• PDB: 6pw1 Structural changes at the surface of cytochrome c oxidase alter the proton-pumping stoichiometry.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 D132 W172 S200 S201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
• Catalytic site (residue number reindexed from 1): H86 D116 W156 S184 S185 H268 E270 Y272 S283 H317 H318 T343 K346 R465
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DMU	A	F35 M443	F19 M427
BS02	DMU	A	P449 W451 F510 G513 Y517	P433 W435 F494 G497 Y501
BS03	DMU	A	M56 Q61 P82	M40 Q45 P66
BS04	HEA	A	G38 T48 M51 R52 W95 I99 H102 M106 M107 V111 G171 W172 Y414 F420 H421 M424 S425 V429 M460 F468 R481 R482 S504 F508	G22 T32 M35 R36 W79 I83 H86 M90 M91 V95 G155 W156 Y398 F404 H405 M408 S409 V413 M444 F452 R465 R466 S488 F492
BS05	HEA	A	W172 W280 V287 Y288 H333 H334 T359 G360 G395 G398 I399 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W156 W264 V271 Y272 H317 H318 T343 G344 G379 G382 I383 L385 S386 D391 H395 V400 H403 F404 V407 M408 R465
BS06	CU	A	H284 H333 H334	H268 H317 H318
BS07	MG	A	H411 D412	H395 D396
BS08	CA	A	E54 A57 G59 Q61	E38 A41 G43 Q45

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:6pw1, PDBe:6pw1, PDBj:6pw1
• PDBsum: 6pw1
• PubMed: 31733183
• UniProt: Q3J5A7