Structure of PDB 6puv Chain A |
>6puvA (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] |
SCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQ KYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWEDCAHFHP DGRWNDDVCQRPYHWVCEAGL |
|
PDB | 6puv Crystal Structure of the Carbohydrate Recognition Domain of the Human Macrophage Galactose C-Type Lectin Bound to GalNAc and the Tumor-Associated Tn Antigen. |
Chain | A |
Resolution | 1.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
V40 N42 E46 E127 |
V39 N41 E45 E118 |
|
|
|